Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7A0C2

Expression Region

1-242

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Ethyl-2,3-dimethylimidazolium bis (trifluoromethylsulfonyl) imide
IL-0106-HP-0500 500 g

1-Ethyl-2,3-dimethylimidazolium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
Mouse Pimreg Pre-designed siRNA Set A
SI110581A 1 Each

Mouse Pimreg Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human C type lectin domain family 2 member D (CLEC2D) ELISA Kit
GTR10351200 96 Well

Human C type lectin domain family 2 member D (CLEC2D) ELISA Kit

Sign In for Pricing
View Details
Goat ADP ribosylation factor like protein 4D (ARL4D) ELISA kit
GTR10453913 96 Well

Goat ADP ribosylation factor like protein 4D (ARL4D) ELISA kit

Sign In for Pricing
View Details
hsa-miR-548a-3p miRNA Agomir
MBS8311053-01 5 nmol

hsa-miR-548a-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-548a-3p miRNA Agomir
MBS8311053-02 10 nmol

hsa-miR-548a-3p miRNA Agomir

Sign In for Pricing
View Details