Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7A4E5

Expression Region

1-242

Origin

Staphylococcus aureus (strain N315)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Fc gamma RIII (CD16) Antibody (1001005) [FITC]
FAB43251F 0.1 mL

Mouse Monoclonal Fc gamma RIII (CD16) Antibody (1001005) [FITC]

Sign In for Pricing
View Details
Rat Acox2 Pre-designed siRNA Set B
SI200157B 1 Each

Rat Acox2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Sncaip sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4033402 1.0 µg DNA

Sncaip sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
pML-T7-6×His-FlaA(Legionella)-Linker-PIP(Legionella)-6×His Plasmid
PVT36715 2 µg

pML-T7-6×His-FlaA(Legionella)-Linker-PIP(Legionella)-6×His Plasmid

Sign In for Pricing
View Details
Rabbit Monoclonal CD20 Antibody (IGEL/1497R) [mFluor Violet 500 SE]
NBP2-49873MFV500 0.1 mL

Rabbit Monoclonal CD20 Antibody (IGEL/1497R) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
MYBBP1A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1371105 3x 1.0 µg

MYBBP1A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details