Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7A4E5

Expression Region

1-242

Origin

Staphylococcus aureus (strain N315)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGGY (NM_001113411) Human Tagged Lenti ORF Clone
RC225971L4 10 µg

FGGY (NM_001113411) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Polk AAV siRNA Pooled Vector
37161166 1.0 µg

Polk AAV siRNA Pooled Vector

Sign In for Pricing
View Details
LCAT Antibody
R31981 100 µg

LCAT Antibody

Sign In for Pricing
View Details
pCMV-CEP85-3×FLAG-Neo Plasmid
PVT59408 2 µg

pCMV-CEP85-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
CD166 Mouse Monoclonal Antibody
AMM81970-01 1 Each

CD166 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD166 Mouse Monoclonal Antibody
AMM81970-02 50 µL

CD166 Mouse Monoclonal Antibody

Sign In for Pricing
View Details