Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q6G7K1

Expression Region

1-242

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-{[ (2,2,2, -Trichloroethyl) oxy]carbonyl} Baccatin III (4S, 5S) -3-Benzoyl-2- (4-methoxyphenyl) -4-phenyl-5-oxazolidinecarboxylate
439335-01 500 µg

7-{[ (2,2,2, -Trichloroethyl) oxy]carbonyl} Baccatin III (4S, 5S) -3-Benzoyl-2- (4-methoxyphenyl) -4-phenyl-5-oxazolidinecarboxylate

Sign In for Pricing
View Details
7-{[ (2,2,2, -Trichloroethyl) oxy]carbonyl} Baccatin III (4S, 5S) -3-Benzoyl-2- (4-methoxyphenyl) -4-phenyl-5-oxazolidinecarboxylate
439335-02 1 mg

7-{[ (2,2,2, -Trichloroethyl) oxy]carbonyl} Baccatin III (4S, 5S) -3-Benzoyl-2- (4-methoxyphenyl) -4-phenyl-5-oxazolidinecarboxylate

Sign In for Pricing
View Details
Olfactory receptor 51A2 discontinued
344956-01 100 µL

Olfactory receptor 51A2 discontinued

Sign In for Pricing
View Details
Olfactory receptor 51A2 discontinued
344956-02 200 µL

Olfactory receptor 51A2 discontinued

Sign In for Pricing
View Details
Anti-PTS Polyclonal Antibody
TMAB-11940-01 50 μL

Anti-PTS Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PTS Polyclonal Antibody
TMAB-11940-02 100 µL

Anti-PTS Polyclonal Antibody

Sign In for Pricing
View Details