Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q6GEW6

Expression Region

1-242

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGT1A7 Rabbit pAb, PerCP-Cy7 conjugated
orb2881600 100 µL

UGT1A7 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
NDUFS1 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62180R-PE-Cy5.5 100 µL

NDUFS1 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
PEnCMV-cys-E3-EGFR (human) (2Synonymous mutation) -Linker-EGFP-SV40-Neo
BZ43249 1 Vial

PEnCMV-cys-E3-EGFR (human) (2Synonymous mutation) -Linker-EGFP-SV40-Neo

Sign In for Pricing
View Details
PDZK1 AAV siRNA Pooled Vector
36356161 1.0 µg

PDZK1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CD3254
BUP22014 1 mg

CD3254

Sign In for Pricing
View Details
Lentiviral human GAN shRNA (UAS) - Lentiviral human GAN shRNA (UAS) (25)
GTR15084965 1 Vial

Lentiviral human GAN shRNA (UAS) - Lentiviral human GAN shRNA (UAS) (25)

Sign In for Pricing
View Details