Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q6GEW6

Expression Region

1-242

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vasoactive Intestinal Peptide Receptor 1 (VIPR1) ELISA Kit
QY-E00733 96 Tests

Human Vasoactive Intestinal Peptide Receptor 1 (VIPR1) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS545080 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
TIE1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1334R-BF750-TR 20 µL

TIE1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Multi Sub Midi Negative Electrode
MS10NE 1 Each

Multi Sub Midi Negative Electrode

Sign In for Pricing
View Details
FLT3, CT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (PE)
MBS6476664-01 0.2 mL

FLT3, CT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (PE)

Sign In for Pricing
View Details
FLT3, CT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (PE)
MBS6476664-02 5x 0.2 mL

FLT3, CT (Tyrosine-protein Kinase Receptor FLT3, Fms-like Tyrosine Kinase 3, FLT-3, STK1, FL Cytokine Receptor, Stem Cell Tyrosine Kinase 1, STK-1, CD135) (PE)

Sign In for Pricing
View Details