Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q6GEW6

Expression Region

1-242

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 8/18 Antibody (rKRT8.18/1346) [Alexa Fluor 750]
NBP3-08300AF750 100 µL

Mouse Monoclonal Cytokeratin 8/18 Antibody (rKRT8.18/1346) [Alexa Fluor 750]

Sign In for Pricing
View Details
Ube4b Mouse qPCR Template Standard (NM_022022)
MK202074 1 Kit

Ube4b Mouse qPCR Template Standard (NM_022022)

Sign In for Pricing
View Details
β-Secretase Inhibitor IV
orb1708141-01 500 µg

β-Secretase Inhibitor IV

Sign In for Pricing
View Details
β-Secretase Inhibitor IV
orb1708141-02 1 mg

β-Secretase Inhibitor IV

Sign In for Pricing
View Details
β-Secretase Inhibitor IV
orb1708141-03 5 mg

β-Secretase Inhibitor IV

Sign In for Pricing
View Details
Recombinant Mouse Nectin-4 (C-6His)
C04U-10ug 10 µg

Recombinant Mouse Nectin-4 (C-6His)

Sign In for Pricing
View Details