Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q99SE9

Expression Region

1-242

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myeloperoxidase Antibody / MPO
V4527-100UG 100 µg

Myeloperoxidase Antibody / MPO

Sign In for Pricing
View Details
ANIB2 Protein Vector (Human) (pPM-C-His)
PV062152 500 ng

ANIB2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recoverin discontinued
513568 100 µg

Recoverin discontinued

Sign In for Pricing
View Details
Recombinant Hepatitis C Virus NS3 Genotype-2c (1192-1459)
MBS142525-01 0.1 mg

Recombinant Hepatitis C Virus NS3 Genotype-2c (1192-1459)

Sign In for Pricing
View Details
Recombinant Hepatitis C Virus NS3 Genotype-2c (1192-1459)
MBS142525-02 0.5 mg

Recombinant Hepatitis C Virus NS3 Genotype-2c (1192-1459)

Sign In for Pricing
View Details
Recombinant Hepatitis C Virus NS3 Genotype-2c (1192-1459)
MBS142525-03 1 mg

Recombinant Hepatitis C Virus NS3 Genotype-2c (1192-1459)

Sign In for Pricing
View Details