Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5IUQ4

Expression Region

1-242

Origin

Staphylococcus aureus (strain JH9)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-p53(S15) Rabbit pAb
GB115050 100 μL

Anti-Phospho-p53(S15) Rabbit pAb

Sign In for Pricing
View Details
Pdcl sgRNA CRISPR Lentivector (Rat) (Target 1)
K7119302 1.0 µg DNA

Pdcl sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PCDHA10 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV626717 1.0 µg DNA

PCDHA10 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ACTR1B Antibody
R36355-100UG 100 µg

ACTR1B Antibody

Sign In for Pricing
View Details
3-D Life RGD Peptide
P10-3 1 Each

3-D Life RGD Peptide

Sign In for Pricing
View Details
Caspase 1 (CASP1) (NM_033294) Human Tagged Lenti ORF Clone
RC218982L3 10 µg

Caspase 1 (CASP1) (NM_033294) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details