Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A6U3J4

Expression Region

1-242

Origin

Staphylococcus aureus (strain JH1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iFluor® 810 Anti-human CD112 Antibody *R2.525*
111200O0-AAT 100 Tests

iFluor® 810 Anti-human CD112 Antibody *R2.525*

Sign In for Pricing
View Details
EIF5 Rabbit Polyclonal Antibody (APC)
orb2600998 100 µg

EIF5 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CYP4F2 Antibody - C-terminal region : Biotin (ARP63725_P050-Biotin)
ARP63725_P050-Biotin 100 µL

CYP4F2 Antibody - C-terminal region : Biotin (ARP63725_P050-Biotin)

Sign In for Pricing
View Details
Leukemia Inhibitory Factor (LIF) Recombinant, Mouse
155647-01 10 µg

Leukemia Inhibitory Factor (LIF) Recombinant, Mouse

Sign In for Pricing
View Details
Leukemia Inhibitory Factor (LIF) Recombinant, Mouse
155647-02 50 µg

Leukemia Inhibitory Factor (LIF) Recombinant, Mouse

Sign In for Pricing
View Details
Leukemia Inhibitory Factor (LIF) Recombinant, Mouse
155647-03 200 µg

Leukemia Inhibitory Factor (LIF) Recombinant, Mouse

Sign In for Pricing
View Details