Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)
This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
A6QIV3
Expression Region
1-242
Origin
Staphylococcus aureus (strain Newman)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M2375-05E-HRP 100 µL
MARCKS, phosphorylated (Ser152/156) (myristoylated alanine-rich protein kinase C substrate, 80K-L, 80K-L Protein, FLJ14368, FLJ90045, MACS, Myristoylated alanine-rich C-kinase substrate, PKCSL, PRKCSL, Protein kinase C substrate, 80kD Protein, Light Chain) (HRP) discontinued
Sign In for Pricing
View Details MBS1068140-01 0.02 mg (E-Coli)
Recombinant Drosophila erecta Trypsin alpha (alphaTry)
Sign In for Pricing
View Details MBS1068140-02 0.1 mg (E-Coli)
Recombinant Drosophila erecta Trypsin alpha (alphaTry)
Sign In for Pricing
View Details