Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit a (atpB)

This Recombinant Staphylococcus aureus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A6QIV3

Expression Region

1-242

Origin

Staphylococcus aureus (strain Newman)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVAD EH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM5 (Intercellular Adhesion Molecule 5, TLN, TLCN) (Biotin)
MBS6421955-01 0.1 mL

ICAM5 (Intercellular Adhesion Molecule 5, TLN, TLCN) (Biotin)

Sign In for Pricing
View Details
ICAM5 (Intercellular Adhesion Molecule 5, TLN, TLCN) (Biotin)
MBS6421955-02 5x 0.1 mL

ICAM5 (Intercellular Adhesion Molecule 5, TLN, TLCN) (Biotin)

Sign In for Pricing
View Details
Chromogranin B (CHGB) Magnetic Fluorescence Assay Kit
MBS2158933-01 96 Tests

Chromogranin B (CHGB) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Chromogranin B (CHGB) Magnetic Fluorescence Assay Kit
MBS2158933-02 5x 96 Tests

Chromogranin B (CHGB) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Chromogranin B (CHGB) Magnetic Fluorescence Assay Kit
MBS2158933-03 10x 96 Tests

Chromogranin B (CHGB) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
2-Methyl-3- (trifluoromethyl) benzenesulfonyl chloride
RXB54546-01 250 mg

2-Methyl-3- (trifluoromethyl) benzenesulfonyl chloride

Sign In for Pricing
View Details