Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas mendocina Cobalamin synthase (cobS)

This Recombinant Pseudomonas mendocina Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4XT57

Expression Region

1-243

Origin

Pseudomonas mendocina (strain ymp)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIAPRIALQFLTRLPVSLPGMPTPEQIGRSLLWYPAVGLLLGLLLWLAHLLLGQTPDVLQ AAIILALWVGLSGGLHLDGLADTADAWVGGFGDPGRTLAIMKDPRSGPIAVVVLVLLLLL KFAALLSLLQAGQGIYLVLLPWLGRSLLPLLLATTPYVRAGGLGQALVDHLPRRQLPWVL GGHVAAMLLLGWGALIALATALALFVWLRRALMQRLGGTTGDTAGALLELAECAALLALA LSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL18 N terminal protein (Avi, His tag)
PDEH100869-01 20 µg

Recombinant Human IL18 N terminal protein (Avi, His tag)

Sign In for Pricing
View Details
Recombinant Human IL18 N terminal protein (Avi, His tag)
PDEH100869-02 100 µg

Recombinant Human IL18 N terminal protein (Avi, His tag)

Sign In for Pricing
View Details
Recombinant Human IL18 N terminal protein (Avi, His tag)
PDEH100869-03 500 µg

Recombinant Human IL18 N terminal protein (Avi, His tag)

Sign In for Pricing
View Details
Recombinant Human IL18 N terminal protein (Avi, His tag)
PDEH100869-04 1 mg

Recombinant Human IL18 N terminal protein (Avi, His tag)

Sign In for Pricing
View Details
iFluor™ 594 Conjugated Cytokeratin 16 Recombinant Rabbit Monoclonal Antibody [SC52-09]
HA720114F 100 µL

iFluor™ 594 Conjugated Cytokeratin 16 Recombinant Rabbit Monoclonal Antibody [SC52-09]

Sign In for Pricing
View Details
RBM6 Antibody
8C10790-AAT 50 µg

RBM6 Antibody

Sign In for Pricing
View Details