Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas mendocina Cobalamin synthase (cobS)

This Recombinant Pseudomonas mendocina Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4XT57

Expression Region

1-243

Origin

Pseudomonas mendocina (strain ymp)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIAPRIALQFLTRLPVSLPGMPTPEQIGRSLLWYPAVGLLLGLLLWLAHLLLGQTPDVLQ AAIILALWVGLSGGLHLDGLADTADAWVGGFGDPGRTLAIMKDPRSGPIAVVVLVLLLLL KFAALLSLLQAGQGIYLVLLPWLGRSLLPLLLATTPYVRAGGLGQALVDHLPRRQLPWVL GGHVAAMLLLGWGALIALATALALFVWLRRALMQRLGGTTGDTAGALLELAECAALLALA LSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY2D Human Gene Knockout Kit (CRISPR)
KN418368 1 Kit

GUCY2D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRAMEF17 (NM_001099851) Human Over-expression Lysate
LC426093 20 µg

PRAMEF17 (NM_001099851) Human Over-expression Lysate

Sign In for Pricing
View Details
BPGM Rabbit Polyclonal Antibody
TA374052 100 µL

BPGM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Atrazine Glutathione Adduct
TRC-A794610-1MG 1 mg

Atrazine Glutathione Adduct

Sign In for Pricing
View Details
ORC2 Rabbit Polyclonal Antibody
TA379494 100 µL

ORC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PIGX (N-term) Rabbit Polyclonal Antibody
AP53302PU-N 400 µL

PIGX (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details