Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Cobalamin synthase (cobS)

This Recombinant Pseudomonas fluorescens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q3KFR3

Expression Region

1-243

Origin

Pseudomonas fluorescens (strain Pf0-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLWIALQFLGSLPIRLPGMPTPEQLGRSLLFYPLVGLLFGVILWALNIALAGTPLLLH AALLLAVWVLLSGALHLDGLADSADAWLGGFGDRERTLTIMKDPRSGPIAVVTLVLVLLL KFAALLALIEQQQSMALIIVPLIGRAALLGLFLTTSYVRAGGLGQALADHLPRKTGWQVL AVSAAVCLVIAGFNAVVALLLAVIVFIWLRHLMVRRLGGTTGDTAGALLELLEMSVLVGL ALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)
TMPY-00191-01 5 µg

ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)

Sign In for Pricing
View Details
ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)
TMPY-00191-02 10 µg

ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)

Sign In for Pricing
View Details
ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)
TMPY-00191-03 20 µg

ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)

Sign In for Pricing
View Details
ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)
TMPY-00191-04 50 µg

ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)

Sign In for Pricing
View Details
ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)
TMPY-00191-05 100 µg

ICAM-5 Protein, Human, Recombinant (aa 1-132, hFc)

Sign In for Pricing
View Details
Anti-gamma Synuclein Rabbit Monoclonal Antibody
M03523 100 µL/Vial

Anti-gamma Synuclein Rabbit Monoclonal Antibody

Sign In for Pricing
View Details