Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Cobalamin synthase (cobS)

This Recombinant Pseudomonas fluorescens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q3KFR3

Expression Region

1-243

Origin

Pseudomonas fluorescens (strain Pf0-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLWIALQFLGSLPIRLPGMPTPEQLGRSLLFYPLVGLLFGVILWALNIALAGTPLLLH AALLLAVWVLLSGALHLDGLADSADAWLGGFGDRERTLTIMKDPRSGPIAVVTLVLVLLL KFAALLALIEQQQSMALIIVPLIGRAALLGLFLTTSYVRAGGLGQALADHLPRKTGWQVL AVSAAVCLVIAGFNAVVALLLAVIVFIWLRHLMVRRLGGTTGDTAGALLELLEMSVLVGL ALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA4B Recombinant Protein (Human)
RP059379 100 µg

FRA4B Recombinant Protein (Human)

Sign In for Pricing
View Details
NFkB p100 Rabbit pAb
APA1077-01 30 µL

NFkB p100 Rabbit pAb

Sign In for Pricing
View Details
NFkB p100 Rabbit pAb
APA1077-02 50 μL

NFkB p100 Rabbit pAb

Sign In for Pricing
View Details
NFkB p100 Rabbit pAb
APA1077-03 100 µL

NFkB p100 Rabbit pAb

Sign In for Pricing
View Details
PLEC1 (Plectin, PCN, PLTN, Hemidesmosomal Protein 1, HD1, Plectin-1, PLEC) (MaxLight 490)
131446-ML490 100 µL

PLEC1 (Plectin, PCN, PLTN, Hemidesmosomal Protein 1, HD1, Plectin-1, PLEC) (MaxLight 490)

Sign In for Pricing
View Details
ZNF598 Rabbit Polyclonal Antibody (HRP)
orb2129966 100 µL

ZNF598 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details