Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. phaseolicola Cobalamin synthase (cobS)

This Recombinant Pseudomonas syringae pv. phaseolicola Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q48FK1

Expression Region

1-243

Origin

Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFWIALQFLGSLPIRLPGMPRPEELGRSLLFYPLVGVVFGMLLLGFSALLSGTPLMLH AALVLSAWVLLSGGLHLDGLADSADAWLGGFGDRERTLQIMKDPRSGPIAVVTLVLVLLL KFAAILALIESHSSIGLLLAPVIGRAAMLGLFLGTPYVRSGGLGQALADHLPRGPGRKVL AATAIACVLLAGWSGVAVLLVCAVCFFWLRQLMMRRLGGCTGDTAGALLELLELAVLLTL ALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS504958 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
CD11a (Cris-3), Biotin conjugate, 0.1mg/mL
BNCB0151-100 1x 100 µL

CD11a (Cris-3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ELF2 (NM_201999) Human Over-expression Lysate
LY403708 100 µg

ELF2 (NM_201999) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-,  30nm
GP-1801-30 1 mL

Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-, 30nm

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right upper lobe
CR562437 5 µg

Tissue Total RNA, Lung: right upper lobe

Sign In for Pricing
View Details
Recombinant Human NME1/NDKA Protein (His Tag)
PKSH030357 50 µg

Recombinant Human NME1/NDKA Protein (His Tag)

Sign In for Pricing
View Details