Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, chloroplastic (atpI)

This Recombinant ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q8MA08

Expression Region

1-243

Origin

Chaetosphaeridium globosum

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQNHESLLFQLSSVEVGQHYYWNIGSFQVHAQVLITSWFVLGLLLGIALIATRKLETIP NTTQNFIEYVLEFIRDLTRTQIGEEEYRSWIPFVGTLFLFIFVSNWSGALIPWKVIELPN GELAAPTNDINTTVALALLTSVAYFYAGLNKKGLSYFGKYIQPTPVLLPINILEDFTKPL SLSFRLFGNILADELVVAVLVSLVPLVIPVPMMFLGLFTSGIQALIFATLAGAYIGESLE GHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JUN (Phospho-S58) Antibody Blocking peptide
orb1449672 500 µg

JUN (Phospho-S58) Antibody Blocking peptide

Sign In for Pricing
View Details
RPS29P13-set siRNA/shRNA/RNAi Lentivector (Human)
42416091 4x 500 ng

RPS29P13-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
IspF Antibody
orb819962 2 mg

IspF Antibody

Sign In for Pricing
View Details
MHC Class 2, DR Monomorphic (MHC Class II) (FITC)
MBS6250068-01 0.1 mL

MHC Class 2, DR Monomorphic (MHC Class II) (FITC)

Sign In for Pricing
View Details
MHC Class 2, DR Monomorphic (MHC Class II) (FITC)
MBS6250068-02 5x 0.1 mL

MHC Class 2, DR Monomorphic (MHC Class II) (FITC)

Sign In for Pricing
View Details
PPT1 (Palmitoyl-protein Thioesterase 1, Palmitoyl-protein Hydrolase 1, PPT-1, PPT) (MaxLight 490)
131732-ML490 100 µL

PPT1 (Palmitoyl-protein Thioesterase 1, Palmitoyl-protein Hydrolase 1, PPT-1, PPT) (MaxLight 490)

Sign In for Pricing
View Details