Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Mitochondrial import inner membrane translocase subunit Tim17 (TIM17)

This Recombinant Arabidopsis thaliana Mitochondrial import inner membrane translocase subunit Tim17 (TIM17) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit Tim17

UniProt

Q9SP35

Expression Region

1-243

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTPETSREPCPDRILDDIGGAFGMGAVGGSAFHFIKGTYNSPKGSRFVGGTQSVSMNAP RTGGSFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGAGAASRSAIFGG VLLALIEGAGIMLNKVLAQPQNMMMEDPGMQGMPGMQGMQGMPGMPGMQGMPGMQGMQMG QMQSQAQIRSESQNQNTASSSSSSSWFGGLFDKKKEEVQPGSESKTEVLESFDAPPVPSF EFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UPK3A (Uroplakin 3A) (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040409-500 1x 500 µL

UPK3A (Uroplakin 3A) (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (TS1), CF594 conjugate, 0.1mg/mL
BNC940627-500 1x 500 µL

Cytokeratin 8 (TS1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF640R conjugate, 0.1mg/mL
BNC402156-500 1x 500 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details