Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Outer membrane protein A (ompA)

This Recombinant Outer membrane protein A (ompA) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Outer membrane protein A, Outer membrane protein II

UniProt

P0C8Z2

Expression Region

1-243

Origin

Escherichia fergusonii

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LTAKLGYPITDDLDIYTRLGGMVWRADTKAHNNVTGESEKNHDTGVSPVFAGGVEWAITP EIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKH FTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLS ERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEV KGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 1- (4-fluorobenzyl) -3-phenyl-1H-pyrazole-5-carboxylate
TZA07055-01 1000 mg

Ethyl 1- (4-fluorobenzyl) -3-phenyl-1H-pyrazole-5-carboxylate

Sign In for Pricing
View Details
Ethyl 1- (4-fluorobenzyl) -3-phenyl-1H-pyrazole-5-carboxylate
TZA07055-02 5000 mg

Ethyl 1- (4-fluorobenzyl) -3-phenyl-1H-pyrazole-5-carboxylate

Sign In for Pricing
View Details
CD31 Polyclonal Antibody
MBS9246685-01 0.1 mL

CD31 Polyclonal Antibody

Sign In for Pricing
View Details
CD31 Polyclonal Antibody
MBS9246685-02 5x 0.1 mL

CD31 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CLPP Antibody
RC-15014-01 50 μL

Recombinant CLPP Antibody

Sign In for Pricing
View Details
Recombinant CLPP Antibody
RC-15014-02 100 µL

Recombinant CLPP Antibody

Sign In for Pricing
View Details