Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Outer membrane protein A (ompA)

This Recombinant Outer membrane protein A (ompA) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Outer membrane protein A, Outer membrane protein II

UniProt

P0C8Z2

Expression Region

1-243

Origin

Escherichia fergusonii

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LTAKLGYPITDDLDIYTRLGGMVWRADTKAHNNVTGESEKNHDTGVSPVFAGGVEWAITP EIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKH FTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLS ERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEV KGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Glypican 3 Antibody (SPM595) [DyLight 488]
NBP2-47761G 0.1 mL

Mouse Monoclonal Glypican 3 Antibody (SPM595) [DyLight 488]

Sign In for Pricing
View Details
NHLRC3 Rabbit Polyclonal Antibody (PerCP)
orb2377346 100 µL

NHLRC3 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
DACH2 Protein Vector (Mouse) (pPM-C-HA)
17637025 500 ng

DACH2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PDE1B Mouse Monoclonal Antibody [Clone ID: OTI6E4]
CF503319 100 µg

PDE1B Mouse Monoclonal Antibody [Clone ID: OTI6E4]

Sign In for Pricing
View Details
E cadherin Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-10009R-PerCP-Cy5.5 100 µL

E cadherin Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
P130 (A-10) HRP
sc-374521 HRP 200 µg/mL

P130 (A-10) HRP

Sign In for Pricing
View Details