Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Outer membrane protein A (ompA)

This Recombinant Outer membrane protein A (ompA) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Outer membrane protein A, Outer membrane protein II

UniProt

P24755

Expression Region

1-243

Origin

Serratia odorifera

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LAAKLSYPIADDLDIYTRLGGMIWRADSKANYGRTGERLSNHDTGVSPLAAVGVEYALTK NWATRLDYQFVSNIGDAGTVGARPDNTMLSLGVSYRFGQDDVVAPAPAPAPAPVVETKLF TLKSDVLFNSAKSSLKPEGQQALDQLYTQLSSMDPKDGSVVVLGYTDPVGKDAANQKLSE ARARSVVDYLVSKGIPADKISARGMGEADQVTDSCGYKNGRATKAQIECLAPNRRVEIEV KGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EDA2R (human) -2-3xFLAG-Neo
BZ62783 1 Vial

PCMV-EDA2R (human) -2-3xFLAG-Neo

Sign In for Pricing
View Details
SOX2 Polyclonal Antibody
A54440-050 50 µL

SOX2 Polyclonal Antibody

Sign In for Pricing
View Details
SPRY4 Protein Vector (Rat) (pPB-C-His)
PV307910 500 ng

SPRY4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
AMY2A Blocking peptide
orb1441056 500 µg

AMY2A Blocking peptide

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1383318-01 0.02 mg (E-Coli)

Recombinant Brucella suis biovar 1 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1383318-02 0.02 mg (Yeast)

Recombinant Brucella suis biovar 1 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details