Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a 1 (atpB1)

This Recombinant Synechococcus sp. ATP synthase subunit a 1 (atpB1) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a 1, ATP synthase F0 sector subunit a 1, F-ATPase subunit 6 1

UniProt

B1XHZ3

Expression Region

1-244

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNSLTTFSLFPLAELEVGKHFYWELGGLKVHGQVLMTSWFVIAVLVLASILATRNVQRV PGGFQNFMEYALEFIRDLAKNQLGEKEYRPWVPFIGTLFLFIFIANWSGALVPWKIIGLP EGELAAPTNDINTTVALALLTSLAYFYAGFKKRGIGYLKKYLEPTPILLPINILEDFTKP LSLSFRLFGNILADELVVGVLVFLVPLIIPLPLMALGLFASAIQALIFATLAAAYIAEAM EGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dinitrophenylhydrazine Hydrochloride
TRC-D481083-500MG 500 mg

2,4-Dinitrophenylhydrazine Hydrochloride

Sign In for Pricing
View Details
Anti-Human IgG4 Antibody
KC-088-01 50 μL

Anti-Human IgG4 Antibody

Sign In for Pricing
View Details
Anti-Human IgG4 Antibody
KC-088-02 100 µL

Anti-Human IgG4 Antibody

Sign In for Pricing
View Details
Anti-Human IgG4 Antibody
KC-088-03 1 mL

Anti-Human IgG4 Antibody

Sign In for Pricing
View Details
Recombinant HLTF Antibody
RC-5272-01 50 μL

Recombinant HLTF Antibody

Sign In for Pricing
View Details
Recombinant HLTF Antibody
RC-5272-02 100 µL

Recombinant HLTF Antibody

Sign In for Pricing
View Details