Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0399 (AF_0399)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0399 (AF_0399) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0399

UniProt

O29848

Expression Region

1-244

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNTDNMSPNFLRNAFRRLTITAIAPIVMTFEPFFIFPVVLITLARRGFVYILLPITAAL ILRATKVNYGPLTVSPTMHFNTPSIAVFAVLLVATTIASVFKPKLWRAFLVAIVVISILH AATPIESPVKGEGCNKISIELLDSETNFCFYISSAKTGKMWYYHATLHFMDSEGLVVNRV HLLTAALTFSSEVVEFRNEQGKFHAIFYSEVPIDSLKLKLCYFPETVIGSLPVVFCSSVD LEVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf40 (SMIM19) Human Gene Knockout Kit (CRISPR)
KN401439 1 Kit

C8orf40 (SMIM19) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Tumor necrosis factor alpha induced protein 8 like protein 2 (TNFAIP8L2) activation kit by CRISPRa
GA112498 1 Kit

Human Tumor necrosis factor alpha induced protein 8 like protein 2 (TNFAIP8L2) activation kit by CRISPRa

Sign In for Pricing
View Details
Cd3e Mouse Gene Knockout Kit (CRISPR)
KN502914 1 Kit

Cd3e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EpCAM Mouse Monoclonal Antibody [3-E1-E2]
EM1111 100 µL

EpCAM Mouse Monoclonal Antibody [3-E1-E2]

Sign In for Pricing
View Details
Human IGFBP-6, Tag Free
HA211086-01 20 µg

Human IGFBP-6, Tag Free

Sign In for Pricing
View Details
Human IGFBP-6, Tag Free
HA211086-02 50 µg

Human IGFBP-6, Tag Free

Sign In for Pricing
View Details