Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0399 (AF_0399)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0399 (AF_0399) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0399

UniProt

O29848

Expression Region

1-244

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNTDNMSPNFLRNAFRRLTITAIAPIVMTFEPFFIFPVVLITLARRGFVYILLPITAAL ILRATKVNYGPLTVSPTMHFNTPSIAVFAVLLVATTIASVFKPKLWRAFLVAIVVISILH AATPIESPVKGEGCNKISIELLDSETNFCFYISSAKTGKMWYYHATLHFMDSEGLVVNRV HLLTAALTFSSEVVEFRNEQGKFHAIFYSEVPIDSLKLKLCYFPETVIGSLPVVFCSSVD LEVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pipette Pump BPIC-203
BPIC-203 1 Unit

Pipette Pump BPIC-203

Sign In for Pricing
View Details
CFAB Bb (Cleaved-Lys260) Antibody
8L0234-AAT 50 µg

CFAB Bb (Cleaved-Lys260) Antibody

Sign In for Pricing
View Details
NKX2.8 (NKX28/2547), CF594 conjugate, 0.1mg/mL
BNC942547-500 1x 500 µL

NKX2.8 (NKX28/2547), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(4-Ethoxycarbonylphenyl)piperazine
TRC-E891610-5G 5 g

1-(4-Ethoxycarbonylphenyl)piperazine

Sign In for Pricing
View Details
Human FASL Antibody Pair Set
E-KAB-0211 50 µL & 100 µg

Human FASL Antibody Pair Set

Sign In for Pricing
View Details
Angiopoietin 2 (ANGPT2) (C-term) Rabbit Polyclonal Antibody
AP50176PU-N 400 µL

Angiopoietin 2 (ANGPT2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details