Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Cobalamin synthase (cobS)

This Recombinant Pseudomonas putida Cobalamin synthase (cobS) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B1J1P0

Expression Region

1-244

Origin

Pseudomonas putida (strain W619)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFWIALQFLSSLPVRLSGMPEPREMGRSLLCYPLVGLLFGLLLWLASHLLQGAPAPLH AALLLTLWVLLSGALHLDGLADSADAWLGGFGDRERTLKIMKDPRSGPIAVVTLVLVLLL KFCALWVLVERGAGALLVLAPVVGRAAMLGLFLGTPYVRPGGLGQALAEHLPRQTAGWVL LGSLLLCLLLGGWSAIWPMALALGVFLWLRRLMCQRLGGTTGDTAGAMLELLELTVVLGL ALAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSF3 Protein Vector (Mouse) (pPM-C-His)
PV151933 500 ng

ACSF3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Anti Human CD44 Flow Cytometry Monoclonal Clone P2A1 PE/TR Ready To Use 100 Tests
IMSAHUCD44P2A1CPETR100 100 Tests

Anti Human CD44 Flow Cytometry Monoclonal Clone P2A1 PE/TR Ready To Use 100 Tests

Sign In for Pricing
View Details
USP21, Human
HY-P701441-01 20 µg

USP21, Human

Sign In for Pricing
View Details
USP21, Human
HY-P701441-02 50 µg

USP21, Human

Sign In for Pricing
View Details
Erythropoietin (EPO) Antibody
orb1711909 1 mL

Erythropoietin (EPO) Antibody

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Ribose-5-phosphate isomerase A (rpiA)
MBS1096365-01 0.02 mg (E-Coli)

Recombinant Klebsiella pneumoniae Ribose-5-phosphate isomerase A (rpiA)

Sign In for Pricing
View Details