Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Claudin-12 (CLDN12)

This Recombinant Bovine Claudin-12 (CLDN12) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Claudin-12

UniProt

Q0IIL2

Expression Region

1-244

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCAR YDGGNDCLMYDAAWYSSVDQLDLRVLQFALPLSILIAMGALLLCLIGMCNTAFRSSVPNI KLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNRKFEPVFAFDYAVYVTVA SAGGLFMTALLLFIWYCACKSLPSPFWQPLYSHPPGMHTYSQPYSARSRLSAIEIDIPVV SHTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmprss11e Mouse Gene Knockout Kit (CRISPR)
KN517934 1 Kit

Tmprss11e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF740 conjugate, 0.1mg/mL
BNC741041-500 1x 500 µL

TRIM29 (TRIM29/1041), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAB11A Rabbit Polyclonal Antibody
TA380603 100 µL

RAB11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD274/PD-L1 Antibody[10F.9G2]
E-AB-F1132UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD274/PD-L1 Antibody[10F.9G2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD274/PD-L1 Antibody[10F.9G2]
E-AB-F1132UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD274/PD-L1 Antibody[10F.9G2]

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), CF488A conjugate, 0.1mg/mL
BNC881014-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details