Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Claudin-12 (CLDN12)

This Recombinant Bovine Claudin-12 (CLDN12) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Claudin-12

UniProt

Q0IIL2

Expression Region

1-244

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCAR YDGGNDCLMYDAAWYSSVDQLDLRVLQFALPLSILIAMGALLLCLIGMCNTAFRSSVPNI KLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNRKFEPVFAFDYAVYVTVA SAGGLFMTALLLFIWYCACKSLPSPFWQPLYSHPPGMHTYSQPYSARSRLSAIEIDIPVV SHTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF594 conjugate, 0.1mg/mL
BNC942076-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPDYE4 Human Gene Knockout Kit (CRISPR)
KN425296 1 Kit

SPDYE4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAHD2A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G1]
TA500979BM 100 µL

FAHD2A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G1]

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562956 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
RPS24 (Center) Rabbit Polyclonal Antibody
AP53738PU-N 400 µL

RPS24 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
High Temperature Circulator BCHT-3302
BCHT-3302 1 Unit

High Temperature Circulator BCHT-3302

Sign In for Pricing
View Details