Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas entomophila Cobalamin synthase (cobS)

This Recombinant Pseudomonas entomophila Cobalamin synthase (cobS) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q1IDJ5

Expression Region

1-244

Origin

Pseudomonas entomophila (strain L48)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFWIALQFLSSLPVRLPGMPTPNEMGRSLLFYPVVGLLFGLLLWLASHLLQGAPAPLH AALLLALWVLLSGALHLDGLADSADAWLGGFGDRERTLQIMKDPRSGPIAVVVLVLVLLL KFCALWVLVERGTGGWLVLAPVVGRAAMLGLFMGTPYVRKGGLGAALAEHLPRRAAGWVL LGSVLGCVVLGGSPGLWMLLLSLGVFLWLRRLMCKRLGGTTGDTAGAMVELLELAVLVGL ALMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL4A2 rabbit pAb
ES4736-01 50 µL

COL4A2 rabbit pAb

Sign In for Pricing
View Details
COL4A2 rabbit pAb
ES4736-02 100 µL

COL4A2 rabbit pAb

Sign In for Pricing
View Details
Histone H3 (tri methyl K36) Mouse mAb
E47M33094 100 µL

Histone H3 (tri methyl K36) Mouse mAb

Sign In for Pricing
View Details
NTRK1 Antibody
A33615-100UG 100 µg

NTRK1 Antibody

Sign In for Pricing
View Details
4921506M07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4948308 1.0 µg DNA

4921506M07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
4-Bromo-2-methyl-1-phenyl-3- ((2,2,2-trifluoroethoxy) methyl) -3-pyrazolin-5-one
FB169626 5000 mg

4-Bromo-2-methyl-1-phenyl-3- ((2,2,2-trifluoroethoxy) methyl) -3-pyrazolin-5-one

Sign In for Pricing
View Details