Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas entomophila Cobalamin synthase (cobS)

This Recombinant Pseudomonas entomophila Cobalamin synthase (cobS) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q1IDJ5

Expression Region

1-244

Origin

Pseudomonas entomophila (strain L48)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFWIALQFLSSLPVRLPGMPTPNEMGRSLLFYPVVGLLFGLLLWLASHLLQGAPAPLH AALLLALWVLLSGALHLDGLADSADAWLGGFGDRERTLQIMKDPRSGPIAVVVLVLVLLL KFCALWVLVERGTGGWLVLAPVVGRAAMLGLFMGTPYVRKGGLGAALAEHLPRRAAGWVL LGSVLGCVVLGGSPGLWMLLLSLGVFLWLRRLMCKRLGGTTGDTAGAMVELLELAVLVGL ALMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ProSAPiP1 Antibody [Alexa Fluor 532]
NBP1-77369AF532 0.1 mL

Rabbit Polyclonal ProSAPiP1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
APC anti-human CD294 (CRTH2)
GT12675 25 Tests

APC anti-human CD294 (CRTH2)

Sign In for Pricing
View Details
Lysophosphatidylcholines
BA2788-25 25 mg

Lysophosphatidylcholines

Sign In for Pricing
View Details
EMP-3 shRNA (h) Lentiviral Particles
sc-97634-V 200 µL

EMP-3 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
HIAT1, CT (HIAT1, Hippocampus abundant transcript 1 protein, Putative tetracycline transporter-like protein) (Biotin)
MBS6306397-01 0.2 mL

HIAT1, CT (HIAT1, Hippocampus abundant transcript 1 protein, Putative tetracycline transporter-like protein) (Biotin)

Sign In for Pricing
View Details
HIAT1, CT (HIAT1, Hippocampus abundant transcript 1 protein, Putative tetracycline transporter-like protein) (Biotin)
MBS6306397-02 5x 0.2 mL

HIAT1, CT (HIAT1, Hippocampus abundant transcript 1 protein, Putative tetracycline transporter-like protein) (Biotin)

Sign In for Pricing
View Details