Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Tetraspanin-7 (TSPAN7)

This Recombinant Pongo pygmaeus Tetraspanin-7 (TSPAN7) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Tetraspanin-7, Tspan-7, Transmembrane 4 superfamily member 2, CD_antigen= CD231

UniProt

Q7YQK9

Expression Region

1-244

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGT GTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYT DAMQTYDGKDDRSQAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQD LHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQ YEMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAI2 (NM_001172743) Human Over-expression Lysate
LY433236 100 µg

RAI2 (NM_001172743) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MAPK6 activation kit by CRISPRa
GA103787 1 Kit

Human MAPK6 activation kit by CRISPRa

Sign In for Pricing
View Details
CRTC3 Human Gene Knockout Kit (CRISPR)
KN418655 1 Kit

CRTC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyanine 5 hydrazide [equivalent to Cy5® hydrazide]
156-AAT 1 mg

Cyanine 5 hydrazide [equivalent to Cy5® hydrazide]

Sign In for Pricing
View Details
PHOS (PDC) Rabbit Polyclonal Antibody
TA362716 100 µL

PHOS (PDC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCAT1 (NM_001178094) Human Over-expression Lysate
LC432972 20 µg

BCAT1 (NM_001178094) Human Over-expression Lysate

Sign In for Pricing
View Details