Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Derlin-2.1 (DER2.1)

This Recombinant Arabidopsis thaliana Derlin-2.1 (DER2.1) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Derlin-2.1, AtDerlin2-1

UniProt

Q8VZ96

Expression Region

1-244

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQAVEEWYKQMPIITRSYLTAAVVTTVGCSLEIISPYNLYLNPTLVVKQYQFWRLVTNF LYFRKMDLDFLFHMFFLARYCKLLEENSFRGKTADFLYMLLFGATVLTGIVLIGGMIPYL SVSFSKIIFLSNSLTFMMVYVWSKQNPYIHMSFLGLFTFTAAYLPWVLLGFSILVGASAW GDFLGMIAGHAYYFLAFVYPRMTDRRPLKTPSFLKALFADEPVVIARPEDVRFAHAPFDE IHQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF594 conjugate, 0.1mg/mL
BNC941925-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (MUC6/916), CF647 conjugate, 0.1mg/mL
BNC470916-500 1x 500 µL

Mucin 6 (MUC6) (MUC6/916), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF488A conjugate, 0.1mg/mL
BNC881993-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details