Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-12 (Cldn12)

This Recombinant Mouse Claudin-12 (Cldn12) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Claudin-12

UniProt

Q9ET43

Expression Region

1-244

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTIYTGLWVKCAR YDGSSDCLMYDRTWYLSVDQLDLRVLQFALPLSIVIAMGALLLCLIGMCNTAFNSSVPNI KLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWAIFYNSHLNRKFEPVFTFDYAVFVTIA SSGGLFMTALLLFVWYCACKSLSSPFWQPLYSHAPGMHTYSQPYSSRSRLSAIEIDIPVV SHST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR beta (RORB) Mouse Monoclonal Antibody [Clone ID: OTI4B7]
CF806944 100 µg

ROR beta (RORB) Mouse Monoclonal Antibody [Clone ID: OTI4B7]

Sign In for Pricing
View Details
Ncf1 Goat Polyclonal Antibody
AP32141PU-N 100 µg

Ncf1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
TSPAN4 (NM_003271) Human Over-expression Lysate
LY418794 100 µg

TSPAN4 (NM_003271) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human TLR4/CD284 Protein (His Tag)
PKSH031834 100 µg

Recombinant Human TLR4/CD284 Protein (His Tag)

Sign In for Pricing
View Details
CD244 Mouse Monoclonal Antibody [Clone ID: OTI1C11]
CF812271 100 µg

CD244 Mouse Monoclonal Antibody [Clone ID: OTI1C11]

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF640R conjugate, 0.1mg/mL
BNC401227-100 1x 100 µL

Thyroglobulin (TGB04 + TGB05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details