Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-12 (Cldn12)

This Recombinant Mouse Claudin-12 (Cldn12) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Claudin-12

UniProt

Q9ET43

Expression Region

1-244

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTIYTGLWVKCAR YDGSSDCLMYDRTWYLSVDQLDLRVLQFALPLSIVIAMGALLLCLIGMCNTAFNSSVPNI KLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWAIFYNSHLNRKFEPVFTFDYAVFVTIA SSGGLFMTALLLFVWYCACKSLSSPFWQPLYSHAPGMHTYSQPYSSRSRLSAIEIDIPVV SHST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione Reductase Recombinant Rabbit Monoclonal Antibody [JE31-42]
HA721989 100 µL

Glutathione Reductase Recombinant Rabbit Monoclonal Antibody [JE31-42]

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF647 conjugate, 0.1mg/mL
BNC470807-500 1x 500 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CO2 Incubator Water Jacketed BCWJ-8303
BCWJ-8303 1 Unit

CO2 Incubator Water Jacketed BCWJ-8303

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]
TA805231BM 100 µL

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]

Sign In for Pricing
View Details
Semenogelin II (SEMG2) (NM_003008) Human Over-expression Lysate
LY418963 100 µg

Semenogelin II (SEMG2) (NM_003008) Human Over-expression Lysate

Sign In for Pricing
View Details
CA3 Antibody
KC-7959-01 50 μL

CA3 Antibody

Sign In for Pricing
View Details