Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tetraspanin-1 (tsp-1)

This Recombinant Tetraspanin-1 (tsp-1) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Tetraspanin-1

UniProt

P34285

Expression Region

1-244

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATWKFIIRSVLFFLDLAMLLAALALIAVGFWMGYDSSFDTDLKNVIYKYDDPKSLADAK FNIRVWLIVVFWSIIGLSLGAVVTAVLGMISSVWPKRKGFMITYLVLIIVLVSLEIGCGV AVLVRRNSLHDNTNSLIDAMYTTNSVNDLKIIQDKYNCCGIENSLFNVMYCGPMSQKPHC DVAVFDSVDNTMMISGIILLVILILQTIAIILPVPILISRKKTYKYSYEPRVTQLADITE DTRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2670806 1.0 µg DNA

ZDHHC23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
JIK, CT (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine/threonine-protein Kinase TAO3, TAO Kinase 3, TAOK3, Thousand and One Amino Acid Protein 3) (MaxLight 490) discontinued
J1260-04C-ML490 100 µL

JIK, CT (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine/threonine-protein Kinase TAO3, TAO Kinase 3, TAOK3, Thousand and One Amino Acid Protein 3) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Phospho-IRF4 (Tyr122/Tyr125) Antibody
MBS9613276-01 0.05 mL

Phospho-IRF4 (Tyr122/Tyr125) Antibody

Sign In for Pricing
View Details
Phospho-IRF4 (Tyr122/Tyr125) Antibody
MBS9613276-02 0.1 mL

Phospho-IRF4 (Tyr122/Tyr125) Antibody

Sign In for Pricing
View Details
Phospho-IRF4 (Tyr122/Tyr125) Antibody
MBS9613276-03 0.2 mL

Phospho-IRF4 (Tyr122/Tyr125) Antibody

Sign In for Pricing
View Details
Phospho-IRF4 (Tyr122/Tyr125) Antibody
MBS9613276-04 5x 0.2 mL

Phospho-IRF4 (Tyr122/Tyr125) Antibody

Sign In for Pricing
View Details