Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tetraspanin-1 (tsp-1)

This Recombinant Tetraspanin-1 (tsp-1) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Tetraspanin-1

UniProt

P34285

Expression Region

1-244

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATWKFIIRSVLFFLDLAMLLAALALIAVGFWMGYDSSFDTDLKNVIYKYDDPKSLADAK FNIRVWLIVVFWSIIGLSLGAVVTAVLGMISSVWPKRKGFMITYLVLIIVLVSLEIGCGV AVLVRRNSLHDNTNSLIDAMYTTNSVNDLKIIQDKYNCCGIENSLFNVMYCGPMSQKPHC DVAVFDSVDNTMMISGIILLVILILQTIAIILPVPILISRKKTYKYSYEPRVTQLADITE DTRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6A2 Antibody
8G658-AAT 50 µg

OR6A2 Antibody

Sign In for Pricing
View Details
Hoechst 33258 analog 3
MBS5755846 Inquire

Hoechst 33258 analog 3

Sign In for Pricing
View Details
NKRF (NM_017544) Human Over-expression Lysate
LY402598 100 µg

NKRF (NM_017544) Human Over-expression Lysate

Sign In for Pricing
View Details
PDZK4 Lentiviral Activation Particles (m)
sc-434136-LAC 200 µL

PDZK4 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
C3AR1 CRISPR Knock Out 293T Cell Line (Human)
14456141 1x 10^6 Cells / 1.0 mL

C3AR1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
USP19 Double Nickase Plasmid (m)
sc-427961-NIC 20 µg

USP19 Double Nickase Plasmid (m)

Sign In for Pricing
View Details