Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ATP synthase subunit a (atpB)

This Recombinant Bacillus subtilis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P37813

Expression Region

1-244

Origin

Bacillus subtilis (strain 168)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHGYRTIEFLGLTFNLTNILMITVASVIVLLIAILTTRTLSIRPGKAQNFMEWIVDFVR NIIGSTMDLKTGANFLALGVTLLMYIFVSNMLGLPFSITIGHELWWKSPTADPAITLTLA VMVVALTHYYGVKMKGLKEYSKDYLRPVPFMLPMKIIEEFANTLTLGLRLYGNIFAGEIL LGLLAGLATSHYSQSVALGLVGTIGAILPMLAWQAFSLFIGAIQAFIFTMLTMVYMSHKI SHDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Iodo Adenosine 2’,3’-Acetonide
TRC-I686675-50MG 50 mg

2-Iodo Adenosine 2’,3’-Acetonide

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701769 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Foxp3 (C-term) Goat Polyclonal Antibody
AP23767PU-N 100 µg

Foxp3 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Ednra activation kit by CRISPRa
GA201181 1 Kit

Mouse Ednra activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse GFRA1/GDNFRA Protein (His Tag)
PKSM040827 100 µg

Recombinant Mouse GFRA1/GDNFRA Protein (His Tag)

Sign In for Pricing
View Details
Human PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit
E-EL-H1577-01 24 Tests

Human PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit

Sign In for Pricing
View Details