Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ATP synthase subunit a (atpB)

This Recombinant Bacillus subtilis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P37813

Expression Region

1-244

Origin

Bacillus subtilis (strain 168)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHGYRTIEFLGLTFNLTNILMITVASVIVLLIAILTTRTLSIRPGKAQNFMEWIVDFVR NIIGSTMDLKTGANFLALGVTLLMYIFVSNMLGLPFSITIGHELWWKSPTADPAITLTLA VMVVALTHYYGVKMKGLKEYSKDYLRPVPFMLPMKIIEEFANTLTLGLRLYGNIFAGEIL LGLLAGLATSHYSQSVALGLVGTIGAILPMLAWQAFSLFIGAIQAFIFTMLTMVYMSHKI SHDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL
BNC741798-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1orf38 (THEMIS2) (NM_001105556) Human Over-expression Lysate
LY426270 100 µg

C1orf38 (THEMIS2) (NM_001105556) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Apc7 (ANAPC7) activation kit by CRISPRa
GA109803 1 Kit

Human Apc7 (ANAPC7) activation kit by CRISPRa

Sign In for Pricing
View Details
TrimL1 Mouse Gene Knockout Kit (CRISPR)
KN518244 1 Kit

TrimL1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BBS7 Human qPCR Primer Pair (NM_176824)
HP228673 200 Reactions

BBS7 Human qPCR Primer Pair (NM_176824)

Sign In for Pricing
View Details
CD72 (B Cell Marker) (BU40), CF640R conjugate, 0.1mg/mL
BNC402906-500 1x 500 µL

CD72 (B Cell Marker) (BU40), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details