Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ATP synthase subunit a (atpB)

This Recombinant Bacillus subtilis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P37813

Expression Region

1-244

Origin

Bacillus subtilis (strain 168)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHGYRTIEFLGLTFNLTNILMITVASVIVLLIAILTTRTLSIRPGKAQNFMEWIVDFVR NIIGSTMDLKTGANFLALGVTLLMYIFVSNMLGLPFSITIGHELWWKSPTADPAITLTLA VMVVALTHYYGVKMKGLKEYSKDYLRPVPFMLPMKIIEEFANTLTLGLRLYGNIFAGEIL LGLLAGLATSHYSQSVALGLVGTIGAILPMLAWQAFSLFIGAIQAFIFTMLTMVYMSHKI SHDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC93B (UNC93B1) Rabbit Polyclonal Antibody
TA367837 100 µL

UNC93B (UNC93B1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC146488 Human qPCR Primer Pair (XM_047748)
HP220792 200 Reactions

LOC146488 Human qPCR Primer Pair (XM_047748)

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF405S conjugate, 0.1mg/mL
BNC042290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIAA1191 (NM_001079685) Human Recombinant Protein
TP303372 20 µg

KIAA1191 (NM_001079685) Human Recombinant Protein

Sign In for Pricing
View Details
MRC2 Rabbit Monoclonal Antibody
TA423572 100 µL

MRC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RTN4IP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]
TA502543AM 100 µL

RTN4IP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details