Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Cobalamin synthase (cobS)

This Recombinant Pseudomonas aeruginosa Cobalamin synthase (cobS) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A6V8S8

Expression Region

1-245

Origin

Pseudomonas aeruginosa (strain PA7)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREALQSLLVALQFLTRLPVRLSAMPTPEQFGRAVLCYPLVGVLIGVVLYGAARSLDGTP PLLQAALLLSLWVALSGALHLDGLADMADAWVGGLGDRERTLAIMKDPRSGPAAVVALVL VLLLKFGALAALLGAGRPGLLLLAPWLARSSLPLLFLTTPYARPGGLGQAIAEHLPARSL PWVLGVSFGLALAFGLSGLLALLVTLMLFAWLRSRFLARLGGTTGDTAGALVELTECAVL VALAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ENA 6 Profile IgG ELISA Kit
DEIA1702 96T

Human ENA 6 Profile IgG ELISA Kit

Sign In for Pricing
View Details
Human Ceramide kinase ELISA Kit
MBS9427123-01 96 Tests

Human Ceramide kinase ELISA Kit

Sign In for Pricing
View Details
Human Ceramide kinase ELISA Kit
MBS9427123-02 5x 96 Tests

Human Ceramide kinase ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Thrombopoietin R CF
4444-TR-050 50 µg

Recombinant Human Thrombopoietin R CF

Sign In for Pricing
View Details
ARHGAP11B Human Gene Knockout Kit (CRISPR)
KN410478 1 Kit

ARHGAP11B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C1orf216 Rabbit Polyclonal Antibody (RBITC)
orb1058452 100 µL

C1orf216 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details