Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 116 (TMEM116)

This Recombinant Human Transmembrane protein 116 (TMEM116) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Transmembrane protein 116

UniProt

Q8NCL8

Expression Region

1-245

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHTQSGQSTSPLVIDYTCRVCQMAFVFSSLIPLLLMTPVFCLGNTSECFQNFSQSHKCI LMHSPPSAMAELPPSANTSVCSTLYFYGIAIFLGSFVLSLLTIMVLLIRAQTLYKKFVKS TGFLGSEQWAVIHIVDQRVRFYPVAFFCCWGPAVILMIIKLTKPQDTKLHMALYVLQALT ATSQGLLNCGVYGWTQHKFHQLKQEARRDADTQTPLLCSQKRFYSRGLNSLESTLTFPAS TSTIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP1 Mouse Monoclonal Antibody [Clone ID: 6A5]
AM06648SU-N 100 µL

MMP1 Mouse Monoclonal Antibody [Clone ID: 6A5]

Sign In for Pricing
View Details
Desmoglein-1 (DSG1) (32-2B), CF740 conjugate, 0.1mg/mL
BNC743068-500 1x 500 µL

Desmoglein-1 (DSG1) (32-2B), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NRF1 Recombinant Rabbit monoclonal Antibody
HA750444 100 µL

NRF1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS626831 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details
beta Casein (CSN2) (NM_001891) Human Recombinant Protein
TP323777L 1 mg

beta Casein (CSN2) (NM_001891) Human Recombinant Protein

Sign In for Pricing
View Details
IFluor® 597 succinimidyl ester
1050-AAT 1 mg

IFluor® 597 succinimidyl ester

Sign In for Pricing
View Details