Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Tetraspanin-6 (TSPAN6)

This Recombinant Pongo abelii Tetraspanin-6 (TSPAN6) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Tetraspanin-6, Tspan-6

UniProt

Q5RAS5

Expression Region

1-245

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B3GAT1 MAb (Clone 1021209)
MAB85602-SP 25 µg

Human B3GAT1 MAb (Clone 1021209)

Sign In for Pricing
View Details
IL-21
E21-C45 10 µg

IL-21

Sign In for Pricing
View Details
Slc1a6 Mouse shRNA Plasmid (Locus ID 20513)
TL502051 1 Kit

Slc1a6 Mouse shRNA Plasmid (Locus ID 20513)

Sign In for Pricing
View Details
Human anti-Echovirus 30 IgG
A11A55-G 1 Each

Human anti-Echovirus 30 IgG

Sign In for Pricing
View Details
Rabbit Low density lipoprotein cholesterol ELISA Kit
MBS754520-01 48 Well

Rabbit Low density lipoprotein cholesterol ELISA Kit

Sign In for Pricing
View Details
Rabbit Low density lipoprotein cholesterol ELISA Kit
MBS754520-02 96 Well

Rabbit Low density lipoprotein cholesterol ELISA Kit

Sign In for Pricing
View Details