Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Tetraspanin-6 (TSPAN6)

This Recombinant Pongo abelii Tetraspanin-6 (TSPAN6) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Tetraspanin-6, Tspan-6

UniProt

Q5RAS5

Expression Region

1-245

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRELD2 Adenovirus (Human)
16823051 1.0 mL

CRELD2 Adenovirus (Human)

Sign In for Pricing
View Details
NF2 Protein Vector (Human) (pPB-C-His)
PV028141 500 ng

NF2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Benzyl (2-phenyloxazol-4-yl) carbamate
OR1040596-01 100 mg

Benzyl (2-phenyloxazol-4-yl) carbamate

Sign In for Pricing
View Details
Benzyl (2-phenyloxazol-4-yl) carbamate
OR1040596-02 250 mg

Benzyl (2-phenyloxazol-4-yl) carbamate

Sign In for Pricing
View Details
Benzyl (2-phenyloxazol-4-yl) carbamate
OR1040596-03 1 g

Benzyl (2-phenyloxazol-4-yl) carbamate

Sign In for Pricing
View Details
C6orf186 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-15232R-PE-Cy5.5 100 µL

C6orf186 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details