Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Desulfovibrio vulgaris Cobalamin synthase (cobS)

This Recombinant Desulfovibrio vulgaris Cobalamin synthase (cobS) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q72DL5

Expression Region

1-245

Origin

Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTFLHHALLACGFLTRLVPARVATADDMAAAVRWFPLAGLVVGGACWLPFALGLAASHP AIQAWLYVLINLWVTRGLHWDGVADLADAWGSSATGERFWDILKDSRIGAFGVMGLLLGF GGQYIGAHEIFISGRLGVLIAAPIVGRGACVILAALVPPGSRSTLGRLTCAGADRIAIGV AATCGMLALLLTTPAITTVTTIAICGAIVTALAHLARREDGINGDFMGACIAGCEGTVLL AASMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-100 1x 100 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD99 (MIC2/877), CF640R conjugate, 0.1mg/mL
BNC400877-100 1x 100 µL

CD99 (MIC2/877), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF740 conjugate, 0.1mg/mL
BNC740507-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details