Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Derlin-1 (cup-2)

This Recombinant Derlin-1 (cup-2) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Derlin-1, Coelomocyte uptake defective protein 2, DER1-like protein 1, cDerlin-1

UniProt

Q93561

Expression Region

1-245

Origin

Caenorhabditis elegans

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIY YPVTPQTGFHWLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFL LEPMVISVLYVWCQVNKDTIVSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGH AYFFVALKYPDEYGVDLISTPEFLHRLIPDEDGGIHGQDGNIRGARQQPRGHQWPGGVGA RLGGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit
MBS2122028-01 24 Strip Well

Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit
MBS2122028-02 48 Strip Well

Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit
MBS2122028-03 96 Strip Well

Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit
MBS2122028-04 5x 96 Strip Well

Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit
MBS2122028-05 10x 96 Strip Well

Human Mitochondrial Trans-2-Enoyl Coenzyme A Reductase (MECR) ELISA Kit

Sign In for Pricing
View Details
C2C12 (STAT3) Luciferase Reporter Cell Line
ABC-RC394H 1 Vial

C2C12 (STAT3) Luciferase Reporter Cell Line

Sign In for Pricing
View Details