Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Cobalamin synthase (cobS)

This Recombinant Pseudomonas aeruginosa Cobalamin synthase (cobS) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q9I463

Expression Region

1-245

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREALRSLLVALQFLTRLPVRLSAMPTPEQFGRAVLCYPLVGVLIGVVLYAAARSLDGTP PLLQAALLLSLWVALSGALHLDGLADMADAWVGGLGDRERTLAIMKDPRSGPVAVVVLVL VLLLKFSALAALLGQGEAGLLPLAPWLARSSLPLLFLTTPYARPGGLGQAIAEHLPARSL PWVLGVSFGLALAFGLAGLLALLVTLMLFAWLRSRFLARLGGTTGDTAGALVELTECAVL VALAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cholesteryl Palmitate
TRC-C432573-2.5G 2.5 g

Cholesteryl Palmitate

Sign In for Pricing
View Details
GBX2 Human Gene Knockout Kit (CRISPR)
KN423461 1 Kit

GBX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EGTA
TRC-E440150-100G 100 g

EGTA

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.10), Biotin conjugate, 0.1mg/mL
BNCB0848-100 1x 100 µL

CD31 / PECAM-1 (C31.10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM115C (TCAF2) (NM_001130025) Human Over-expression Lysate
LY427110 100 µg

FAM115C (TCAF2) (NM_001130025) Human Over-expression Lysate

Sign In for Pricing
View Details
Fusaric Acid
TRC-F865400-1G 1 g

Fusaric Acid

Sign In for Pricing
View Details