Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Cobalamin synthase (cobS)

This Recombinant Pseudomonas aeruginosa Cobalamin synthase (cobS) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q9I463

Expression Region

1-245

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREALRSLLVALQFLTRLPVRLSAMPTPEQFGRAVLCYPLVGVLIGVVLYAAARSLDGTP PLLQAALLLSLWVALSGALHLDGLADMADAWVGGLGDRERTLAIMKDPRSGPVAVVVLVL VLLLKFSALAALLGQGEAGLLPLAPWLARSSLPLLFLTTPYARPGGLGQAIAEHLPARSL PWVLGVSFGLALAFGLAGLLALLVTLMLFAWLRSRFLARLGGTTGDTAGALVELTECAVL VALAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Peripheral nerve
CS704472 5x 5 µm

Tissue FFPE Sections, Peripheral nerve

Sign In for Pricing
View Details
N-Propylboronic Acid
TRC-P835060-2.5G 2.5 g

N-Propylboronic Acid

Sign In for Pricing
View Details
1H-Phenalen-1-one
TRC-H188145-500MG 500 mg

1H-Phenalen-1-one

Sign In for Pricing
View Details
Viva 2-Steps RT-PCR Kit with M-MULV RT / Taq DNA Polymerase, 100app
RTPL12 100 Applications

Viva 2-Steps RT-PCR Kit with M-MULV RT / Taq DNA Polymerase, 100app

Sign In for Pricing
View Details
4-Acetamidobenzene-d4-sulfonyl Chloride
TRC-A170951-50MG 50 mg

4-Acetamidobenzene-d4-sulfonyl Chloride

Sign In for Pricing
View Details
Mouse CD48 Antibody Pair Set
E-KAB-0699 50 µL & 100 µg

Mouse CD48 Antibody Pair Set

Sign In for Pricing
View Details