Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-16 (TSPAN16)

This Recombinant Human Tetraspanin-16 (TSPAN16) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Tetraspanin-16, Tspan-16, Tetraspanin TM4-B, Transmembrane 4 superfamily member 16

UniProt

Q9UKR8

Expression Region

1-245

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEIHTPYSSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNL CLVMGCITVLLGCAGWYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVAL EHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCC KSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQSFTLSGSSLGAAVIQRWGSRYVAQAG LELLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myc (MYC275), CF568 conjugate, 0.1mg/mL
BNC680275-100 1x 100 µL

C-Myc (MYC275), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CROCCP3 Antibody
KC-3703-01 50 μL

CROCCP3 Antibody

Sign In for Pricing
View Details
CROCCP3 Antibody
KC-3703-02 100 µL

CROCCP3 Antibody

Sign In for Pricing
View Details
CROCCP3 Antibody
KC-3703-03 1 mL

CROCCP3 Antibody

Sign In for Pricing
View Details
Complement C8A (C8A) (NM_000562) Human Over-expression Lysate
LY424641 100 µg

Complement C8A (C8A) (NM_000562) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS807252 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details