Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-16 (TSPAN16)

This Recombinant Human Tetraspanin-16 (TSPAN16) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Tetraspanin-16, Tspan-16, Tetraspanin TM4-B, Transmembrane 4 superfamily member 16

UniProt

Q9UKR8

Expression Region

1-245

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEIHTPYSSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNL CLVMGCITVLLGCAGWYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVAL EHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCC KSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQSFTLSGSSLGAAVIQRWGSRYVAQAG LELLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

all-trans-Retinoic Acid-d5 (major)
TRC-R250202-2.5MG 2.5 mg

all-trans-Retinoic Acid-d5 (major)

Sign In for Pricing
View Details
Ybx2 Mouse Gene Knockout Kit (CRISPR)
KN519541 1 Kit

Ybx2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 (CCL23) Rabbit Polyclonal Antibody
TA371283 100 µL

Macrophage Inflammatory Protein 3 (CCL23) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QuantiChrom™ Hemoglobin Assay Kit
DIHB-250 250 Tests

QuantiChrom™ Hemoglobin Assay Kit

Sign In for Pricing
View Details
(2S,4R)-4-Aminopyrrolidine-2-carboxylic Acid Dihydrochloride
TRC-A578840-10MG 10 mg

(2S,4R)-4-Aminopyrrolidine-2-carboxylic Acid Dihydrochloride

Sign In for Pricing
View Details
Smg7 Mouse Gene Knockout Kit (CRISPR)
KN516313 1 Kit

Smg7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details