Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-6 (TSPAN6)

This Recombinant Human Tetraspanin-6 (TSPAN6) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Tetraspanin-6, Tspan-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6

UniProt

O43657

Expression Region

1-245

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,3’,5’-Triiodo-L-thyronine
TRC-T795350-5MG 5 mg

3,3’,5’-Triiodo-L-thyronine

Sign In for Pricing
View Details
Olfactory receptor 10G2 Polyclonal Antibody
RA28034-01 50 µL

Olfactory receptor 10G2 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 10G2 Polyclonal Antibody
RA28034-02 100 µL

Olfactory receptor 10G2 Polyclonal Antibody

Sign In for Pricing
View Details
C16orf55 Peptide - N-terminal region (AAP69219)
AAP69219-100UG 100 µg

C16orf55 Peptide - N-terminal region (AAP69219)

Sign In for Pricing
View Details
Mouse Ube2ql1 qPCR Primer Pair
QM45390S 200 Tests

Mouse Ube2ql1 qPCR Primer Pair

Sign In for Pricing
View Details
IL 28A Recombinant Protein
32-1503-20 20 µg

IL 28A Recombinant Protein

Sign In for Pricing
View Details